Protein Purification
MilliporeSigma™ Calbiochem™ Adenosine A3 Receptor Agonist, 2-Cl-IB-MECA
A highly selective agonist of adenosine A3 receptor (Ki = 330 pM).
MilliporeSigma™ Calbiochem™ MMP Inhibitor V
The MMP Inhibitor V, also referenced under CAS 223472-31-9, controls the biological activity of MMP. This small molecule/inhibitor is primarily used for Protease Inhibitors applications.
MilliporeSigma™ Calbiochem™ Luciferase Inhibitor II
The Luciferase Inhibitor II, also referenced under CAS 10205-56-8, controls the biological activity of Luciferase.
MilliporeSigma™ Calbiochem™ GSK-3 Inhibitor X
The GSK-3 Inhibitor X, also referenced under CAS 740841-15-0, controls the biological activity of GSK-3. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ Formyl Peptide Receptor-Like 1 Antagonist, WRW4
The Formyl Peptide Receptor-Like 1 Antagonist, WRW4 controls the biological activity of Formyl Peptide Receptor-Like 1.
MilliporeSigma™ Calbiochem™ Dkk-1 Inhibitor, WAY-262611, HCl
The Dkk-1 Inhibitor, WAY-262611 controls the biological activity of Dkk-1.
MilliporeSigma™ Calbiochem™ ERK Activation Inhibitor Peptide II, Cell-Permeable
The ERK Activation Inhibitor Peptide II, Cell-Permeable controls the biological activity of ERK. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ IκB Kinase Inhibitor Peptide, Cell-Permeable
The IκB Kinase Inhibitor Peptide, Cell-Permeable controls the biological activity of IκB Kinase. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ Protease Inhibitor Cocktail Set III, Animal-Free
Protease Inhibitor Cocktail Set III, Animal-Free, is a cocktail of six protease inhibitors with broad specificity for the inhibition of aspartic, cysteine & serine proteases & aminopeptidases.
MilliporeSigma™ Calbiochem™ MT1-MMP Inhibitor, NSC405020
The MT1-MMP Inhibitor, NSC405020 controls the biological activity of MT1-MMP. This small molecule/inhibitor is primarily used for Protease Inhibitors applications.
MilliporeSigma™ Calbiochem™ EGFR Activator, NSC 228155
A nitro-benzoxadiazole compound that directly binds to the dimerization domain of sEGF receptor to generate stable dimers and allosterically activate the receptor.
MilliporeSigma™ Calbiochem™ Triptolide, Tripterygium wilfordii
A novel diterpene triepoxide isolated from the Chinese herb Tripterygium wilfordii that acts as a potent immunosuppressant and anti-inflammatory agent.
MilliporeSigma™ Calbiochem™ NAE Inhibitor, MLN4924
NAE Inhibitor, MLN4924, CAS 951950-33-7, is an AMP mimetic that forms a NAE-catalyzed NEDD8 adduct, which acts as a tight-binding, ATP-competitive NAE inhibitor (IC50 = 4.7nM).
MilliporeSigma™ Calbiochem™ Diethyl Pyrocarbonate
Inhibits ryanodine binding to ryanodine/Ca2+ receptor channel in skeletal muscle in a dose- and time-dependent manner and increases the Ca2+ permeability of SR vesicles.